Rabbit CDH23 antibody
-
Catalog number70R-6179
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenCDH23 antibody was raised using the middle region of CDH23 corresponding to a region with amino acids DYISGVLTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNI
-
SpecificityCDH23 antibody was raised against the middle region of CDH23
-
Cross ReactivityHuman,Mouse
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CDH23 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolCDH23, CDH23-AS1
-
Short nameRabbit CDH23 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal CDH23 antibody raised against the middle region of CDH23
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetcadherin-related 23, CDH23 and IDBG-77620 and ENSG00000107736 and 100653137,64072, protein binding, Plasma membranes
-
Gene info
-
Identity
-
Gene
-
Long gene namecadherin related 23
-
Synonyms gene
-
Synonyms gene name
- cadherin-like 23
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2000-10-19
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- MicroRNA protein coding host genes
- Cadherin related
-
VEGA ID
-
Locus Specific Databases
Gene info
-
Identity
-
Gene
-
Long gene nameCDH23 antisense RNA 1
-
Synonyms gene
-
Synonyms gene name
- chromosome 10 open reading frame 106
- non-protein coding RNA 223
- CDH23 antisense RNA 1 (non-protein coding)
-
Synonyms
-
Locus
-
Discovery year2004-05-27
-
Entrez gene record
-
Classification
- Antisense RNAs
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data