Rabbit CD8B antibody
-
Catalog number70R-5987
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaImmunology
-
ImmunogenCD8B antibody was raised using the middle region of CD8B corresponding to a region with amino acids KPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCR
-
SpecificityCD8B antibody was raised against the middle region of CD8B
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CD8B antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolCD8B
-
Short nameRabbit CD8B antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal CD8B antibody raised against the middle region of CD8B
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetCD8b molecule, CD8B and IDBG-60041 and ENSG00000172116 and 100996919,926, MHC class I protein binding, Extracellular, Cd8b1 and IDBG-155547 and ENSMUSG00000053044 and 12526, CD8B and IDBG-634906 and ENSBTAG00000008956 and 508633
-
Gene info
-
Identity
-
Gene
-
Long gene nameCD8b molecule
-
Synonyms gene
-
Synonyms gene name
- CD8 antigen, beta polypeptide 1 (p37)
-
Locus
-
Discovery year1989-04-13
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- CD molecules
- V-set domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data