Rabbit CD8B antibody

• Catalog number
  70R-5987
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Immunology
• Immunogen
  CD8B antibody was raised using the middle region of CD8B corresponding to a region with amino acids KPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCR
• Specificity
  CD8B antibody was raised against the middle region of CD8B
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CD8B antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  CD8B  
• Gene symbol
  CD8B
• Short name
  Rabbit CD8B antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal CD8B antibody raised against the middle region of CD8B
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  CD8b molecule, CD8B and IDBG-60041 and ENSG00000172116 and 100996919,926, MHC class I protein binding, Extracellular, Cd8b1 and IDBG-155547 and ENSMUSG00000053044 and 12526, CD8B and IDBG-634906 and ENSBTAG00000008956 and 508633

Gene info

• Identity
  HGNC:1707
• Gene
  CD8B
• Long gene name
  CD8b molecule
• Synonyms gene
  • CD8B1
• Synonyms gene name
  • CD8 antigen, beta polypeptide 1 (p37)
• Locus
  2p11.2
• Discovery year
  1989-04-13
• Entrez gene record
  926
• Pubmed identfication
  • 1541829
• RefSeq identity
  • NM_172099
• Classification
  • CD molecules
  • V-set domain containing
• VEGA ID
  OTTHUMG00000130264

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products