Rabbit CAP1 antibody
-
Catalog number70R-5729
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenCAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQEN
-
SpecificityNA
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CAP1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolCAP1, PRSS8
-
Short nameRabbit CAP1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal CAP1 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetCAP, adenylate cyclase-associated protein 1 (yeast), CAP and CAP1-PEN, CAP1 and IDBG-96837 and ENSG00000131236 and 10487, protein binding, Plasma membranes, Cap1 and IDBG-184645 and ENSMUSG00000028656 and 12331, CAP1 and IDBG-640831 and ENSBTAG00000013363 and 504519
-
Gene info
-
Identity
-
Gene
-
Long gene namecyclase associated actin cytoskeleton regulatory protein 1
-
Synonyms gene name
- CAP, adenylate cyclase-associated protein 1 (yeast)
- adenylate cyclase associated protein 1
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2003-07-17
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameserine protease 8
-
Synonyms gene name
- protease, serine 8
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1995-10-17
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Serine proteases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data