Rabbit CACNB4 antibody

• Catalog number
  70R-5045
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Signal Transduction
• Immunogen
  CACNB4 antibody was raised using the C terminal of CACNB4 corresponding to a region with amino acids LEAYWRATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHS
• Specificity
  CACNB4 antibody was raised against the C terminal of CACNB4
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CACNB4 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  CACNB4  
• Gene symbol
  CACNB4
• Short name
  Rabbit CACNB4 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal CACNB4 antibody raised against the C terminal of CACNB4
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  calcium channel, voltage-dependent, beta 4 subunit, CAB4 and CACNLB4 and EA5 and EIG9 and EJM and EJM4 and EJM6, CACNB4 and IDBG-72371 and ENSG00000182389 and 785, protein kinase binding, Plasma membranes, Cacnb4 and IDBG-170902 and ENSMUSG00000017412 and 12298, CACNB4 and IDBG-641796 and ENSBTAG00000002297 and 282161

Gene info

• Identity
  HGNC:1404
• Gene
  CACNB4
• Long gene name
  calcium voltage-gated channel auxiliary subunit beta 4
• Synonyms gene name
  • calcium channel, voltage-dependent, beta 4 subunit
• Synonyms
  • EJM4
• GenBank acession
  • AF038852
• Locus
  2q23.3
• Discovery year
  1997-04-21
• Entrez gene record
  785
• Pubmed identfication
  • 9628818
• RefSeq identity
  • NM_000726.3
• Classification
  • Membrane associated guanylate kinases
  • Calcium voltage-gated channel auxiliary beta subunits
• VEGA ID
  OTTHUMG00000155091

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products