Rabbit C4BPB antibody

• Catalog number
  70R-5917
• Price
  Please ask
• Size
  50 ug

• Applications
  WB, IHC
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Immunology
• Immunogen
  C4BPB antibody was raised using the N terminal of C4BPB corresponding to a region with amino acids CCLMVAWRVSASDAEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLV
• Specificity
  C4BPB antibody was raised against the N terminal of C4BPB
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C4BPB antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  C4BPB  
• Gene symbol
  C4BPB
• Short name
  Rabbit C4BPB antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal C4BPB antibody raised against the N terminal of C4BPB
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  complement component 4 binding protein, beta, C4BP, C4BPB and IDBG-106321 and ENSG00000123843 and 725, protein binding, Extracellular, C4BPB and IDBG-629249 and ENSBTAG00000017714 and 281652

Gene info

• Identity
  HGNC:1328
• Gene
  C4BPB
• Long gene name
  complement component 4 binding protein beta
• Synonyms gene
  • C4BP
• Synonyms gene name
  • complement component 4-binding protein, beta
• Synonyms name
  • complement component 4 binding protein, beta chain
  • C4b binding protein, beta chain
• GenBank acession
  • L11245
• Locus
  1q32.1
• Discovery year
  1990-06-13
• Entrez gene record
  725
• Pubmed identfication
  • 2300577
  • 8325877
• RefSeq identity
  • NM_000716
• Classification
  • Sushi domain containing
  • Complement system regulators and receptors
• VEGA ID
  OTTHUMG00000036035
• Locus Specific Databases
  • LRG_603

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products