Rabbit C22ORF28 antibody
-
Catalog number70R-4338
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDNA & RNA
-
ImmunogenC22ORF28 antibody was raised using the N terminal Of C22Orf28 corresponding to a region with amino acids PEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQAMFDHIPVGVG
-
SpecificityC22ORF28 antibody was raised against the N terminal Of C22Orf28
-
Cross ReactivityHuman, Mouse, Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C22ORF28 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolRTCB
-
Short nameRabbit C22ORF28 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal C22ORF28 antibody raised against the N terminal Of C22Orf28
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetchromosome 22 open reading frame 28, C22orf28 and IDBG-5110 and ENSG00000100220 and 51493, metal ion binding, Cytoplasm, D10Wsu52e and IDBG-181765 and ENSMUSG00000001783 and 28088, C5H22orf28 and IDBG-637793 and ENSBTAG00000011070 and 525106
-
Gene info
-
Identity
-
Gene
-
Long gene nameRNA 2',3'-cyclic phosphate and 5'-OH ligase
-
Synonyms gene
-
Synonyms gene name
- chromosome 22 open reading frame 28
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2006-07-04
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- tRNA splicing ligase complex
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data