Rabbit C1QTNF7 antibody
-
Catalog number70R-5472
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCancer
-
ImmunogenC1QTNF7 antibody was raised using the middle region of C1QTNF7 corresponding to a region with amino acids SIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPATGKFICAFPGI
-
SpecificityC1QTNF7 antibody was raised against the middle region of C1QTNF7
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C1QTNF7 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolC1QTNF7-AS1, C1QTNF7
-
Short nameRabbit C1QTNF7 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal C1QTNF7 antibody raised against the middle region of C1QTNF7
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetC1q and tumor necrosis factor related protein 7, C1QTNF7 and IDBG-10411 and ENSG00000163145 and 114905, protein binding, Extracellular, C1qtnf7 and IDBG-160924 and ENSMUSG00000061535 and 109323, BT.19274 and IDBG-643966 and ENSBTAG00000010343 and 540131
-
Gene info
-
Identity
-
Gene
-
Long gene nameC1QTNF7 antisense RNA 1
-
Locus
-
Discovery year2019-07-24
-
Entrez gene record
-
Classification
- Antisense RNAs
Gene info
-
Identity
-
Gene
-
Long gene nameC1q and TNF related 7
-
Synonyms gene name
- C1q and tumor necrosis factor related protein 7
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2001-10-02
-
Entrez gene record
-
Classification
- C1q and TNF related
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data