Rabbit C1QTNF1 antibody
-
Catalog number70R-7173
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCancer
-
ImmunogenC1QTNF1 antibody was raised using the N terminal of C1QTNF1 corresponding to a region with amino acids YPATAVPQINITILKGEKGDRGDRGLQGKYGKTGSAGARGHTGPKGQKGS
-
SpecificityC1QTNF1 antibody was raised against the N terminal of C1QTNF1
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C1QTNF1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolC1QTNF1-AS1, C1QTNF1
-
Short nameRabbit C1QTNF1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal C1QTNF1 antibody raised against the N terminal of C1QTNF1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetC1q and tumor necrosis factor related protein 1, C1QTNF1 and IDBG-71074 and ENSG00000173918 and 114897, collagen binding, Extracellular, C1qtnf1 and IDBG-214646 and ENSMUSG00000017446 and 56745, C1QTNF1 and IDBG-642779 and ENSBTAG00000006276 and 511774
-
Gene info
-
Identity
-
Gene
-
Long gene nameC1QTNF1 antisense RNA 1
-
Locus
-
Discovery year2013-05-21
-
Entrez gene record
-
Classification
- Antisense RNAs
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameC1q and TNF related 1
-
Synonyms gene name
- C1q and tumor necrosis factor related protein 1
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2001-10-02
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- C1q and TNF related
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data