Rabbit C1QB antibody

• Catalog number
  70R-5985
• Price
  Please ask
• Size
  50 ug

• Applications
  WB, IHC
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Immunology
• Immunogen
  C1QB antibody was raised using the C terminal of C1QB corresponding to a region with amino acids AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD
• Specificity
  C1QB antibody was raised against the C terminal of C1QB
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C1QB antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  C1QB  
• Gene symbol
  C1QB
• Short name
  Rabbit C1QB antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal C1QB antibody raised against the C terminal of C1QB
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  complement component 1, q subcomponent, B chain, C1QB and IDBG-93747 and ENSG00000173369 and 713, protein homodimerization activity, Extracellular, C1qb and IDBG-198224 and ENSMUSG00000036905 and 12260, C1QB and IDBG-645500 and ENSBTAG00000011196 and 617435

Gene info

• Identity
  HGNC:1242
• Gene
  C1QB
• Long gene name
  complement C1q B chain
• Synonyms gene name
  • complement component 1, q subcomponent, beta polypeptide
  • complement component 1, q subcomponent, B chain
  • complement C1q chain B
• GenBank acession
  • X03084
• Locus
  1p36.12
• Discovery year
  2001-06-22
• Entrez gene record
  713
• Pubmed identfication
  • 1537612
• RefSeq identity
  • NM_000491
• Classification
  • Complement system activation components
  • C1q domain containing
• VEGA ID
  OTTHUMG00000002896
• Locus Specific Databases
  • C1QBbase: Mutation registry for C1qB deficiency
  • LRG_23

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products