Rabbit BMP6 antibody
-
Catalog number70R-6201
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDifferentiation & Development
-
ImmunogenBMP6 antibody was raised using the middle region of BMP6 corresponding to a region with amino acids MVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSEL
-
SpecificityBMP6 antibody was raised against the middle region of BMP6
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BMP6 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolBMP6
-
Short nameRabbit BMP6 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal BMP6 antibody raised against the middle region of BMP6
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetbone morphogenetic protein 6, VGR and VGR1, BMP6 and IDBG-60018 and ENSG00000153162 and 654, BMP receptor binding, Extracellular, Bmp6 and IDBG-145907 and ENSMUSG00000039004 and 12161, BMP6 and IDBG-636350 and ENSBTAG00000019234 and 617566
-
Gene info
-
Identity
-
Gene
-
Long gene namebone morphogenetic protein 6
-
Synonyms gene
-
Synonyms gene name
- vegetal related growth factor (TGFB-related)
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1991-06-05
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Bone morphogenetic proteins
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data