Rabbit BLNK antibody

• Catalog number
  70R-5736
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Immunology
• Immunogen
  BLNK antibody was raised using the middle region of BLNK corresponding to a region with amino acids QYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKV
• Specificity
  BLNK antibody was raised against the middle region of BLNK
• Cross Reactivity
  Human, Mouse, Rat
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BLNK antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  BLNK  
• Gene symbol
  BLNK
• Short name
  Rabbit BLNK antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal BLNK antibody raised against the middle region of BLNK
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  B-cell linker, BLNK and IDBG-83724 and ENSG00000095585 and 29760, protein binding, Plasma membranes, Blnk and IDBG-165316 and ENSMUSG00000061132 and 17060, BT.24520 and IDBG-638042 and ENSBTAG00000021358 and 510393

Gene info

• Identity
  HGNC:14211
• Gene
  BLNK
• Long gene name
  B cell linker
• Synonyms
  • SLP65
  • Ly57
  • SLP-65
  • BLNK-s
  • BASH
  • bca
• Synonyms name
  • B-cell adapter containing a SH2 domain protein
  • B-cell activation
  • Src homology [SH2] domain-containing leukocyte protein of 65 kD
  • B cell adaptor containing SH2 domain
• GenBank acession
  • AF068180
• Locus
  10q24.1
• Discovery year
  2001-07-16
• Entrez gene record
  29760
• Pubmed identfication
  • 9697839
  • 10583958
• RefSeq identity
  • NM_013314
• Classification
  • SH2 domain containing
• VEGA ID
  OTTHUMG00000018827
• Locus Specific Databases
  • BLNKbase: Mutation registry for BLNK deficiency
  • LRG_21

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products