Rabbit BLK antibody

• Catalog number
  70R-1644
• Price
  Please ask
• Size
  100 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Immunology
• Immunogen
  BLK antibody was raised using the middle region of BLK corresponding to a region with amino acids AVVTKEPIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQIAEGMAY
• Specificity
  BLK antibody was raised against the middle region of BLK
• Cross Reactivity
  Human,Mouse,Rat
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of BLK antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  BLK  
• Gene symbol
  BLK
• Short name
  Rabbit BLK antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal BLK antibody raised against the middle region of BLK
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  B lymphoid tyrosine kinase, MODY11, BLK and IDBG-7345 and ENSG00000136573 and 640, transferase activity, Plasma membranes, Blk and IDBG-172522 and ENSMUSG00000014453 and 12143, BLK and IDBG-629427 and ENSBTAG00000005049 and 532587

Gene info

• Identity
  HGNC:1057
• Gene
  BLK
• Long gene name
  BLK proto-oncogene, Src family tyrosine kinase
• Synonyms gene name
  • B lymphoid tyrosine kinase
• Synonyms
  • MGC10442
• GenBank acession
  • BC004473
• Locus
  8p23.1
• Discovery year
  1995-05-17
• Entrez gene record
  640
• Pubmed identfication
  • 7845672
• Classification
  • SH2 domain containing
  • Src family tyrosine kinases
• VEGA ID
  OTTHUMG00000090729

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products