Rabbit BBS4 antibody
-
Catalog number70R-4575
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaMiscellaneous
-
ImmunogenBBS4 antibody was raised using the N terminal of BBS4 corresponding to a region with amino acids YVQALIFRLEGNIQESLELFQTCAVLSPQSADNLKQVARSLFLLGKHKAA
-
SpecificityBBS4 antibody was raised against the N terminal of BBS4
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BBS4 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolBBS4
-
Short nameRabbit BBS4 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal BBS4 antibody raised against the N terminal of BBS4
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetBardet-Biedl syndrome 4, BBS4 and IDBG-20881 and ENSG00000140463 and 585, beta-tubulin binding, multiple, Bbs4 and IDBG-172547 and ENSMUSG00000025235 and 102774, BBS4 and IDBG-645611 and ENSBTAG00000007614 and 532120
-
Gene info
-
Identity
-
Gene
-
Long gene nameBardet-Biedl syndrome 4
-
GenBank acession
-
Locus
-
Discovery year1995-07-11
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- BBSome
- Tetratricopeptide repeat domain containing
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data