Rabbit ATP4B antibody
-
Catalog number70R-6951
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaProteases, Inhibitors, & Enzymes
-
ImmunogenATP4B antibody was raised using the middle region of ATP4B corresponding to a region with amino acids QVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCK
-
SpecificityATP4B antibody was raised against the middle region of ATP4B
-
Cross ReactivityHuman,Mouse,Rat,Dog
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATP4B antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolATP4B
-
Short nameRabbit ATP4B antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ATP4B antibody raised against the middle region of ATP4B
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetATPase, H+/K+ exchanging, beta polypeptide, ATP6B, ATP4B and IDBG-53569 and ENSG00000186009 and 496, potassium-exchanging ATPase activity, Plasma membranes, Atp4b and IDBG-135260 and ENSMUSG00000031449 and 11945, BT.29440 and IDBG-634494 and ENSBTAG00000019961 and 614308
-
Gene info
-
Identity
-
Gene
-
Long gene nameATPase H+/K+ transporting subunit beta
-
Synonyms gene name
- ATPase, H+/K+ exchanging, beta polypeptide
- ATPase H+/K+ transporting beta subunit
-
Synonyms
-
Locus
-
Discovery year1992-11-26
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- ATPase H+/K+ transporting
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data