Rabbit ATP2C1 antibody
-
Catalog number70R-5961
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaProteases, Inhibitors, & Enzymes
-
ImmunogenATP2C1 antibody was raised using the C terminal of ATP2C1 corresponding to a region with amino acids TKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILGLA
-
SpecificityATP2C1 antibody was raised against the C terminal of ATP2C1
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATP2C1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolATP2C1
-
Short nameRabbit ATP2C1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ATP2C1 antibody raised against the C terminal of ATP2C1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetATPase, Ca++ transporting, type 2C, member 1, ATP2C1 and IDBG-56432 and ENSG00000017260 and 27032, metal ion binding, Plasma membranes, Atp2c1 and IDBG-195296 and ENSMUSG00000032570 and 235574, ATP2C1 and IDBG-639111 and ENSBTAG00000011626 and 327663
-
Gene info
-
Identity
-
Gene
-
Long gene nameATPase secretory pathway Ca2+ transporting 1
-
Synonyms gene
-
Synonyms gene name
- benign chronic pemphigus (Hailey-Hailey disease)
- ATPase, Ca++ transporting, type 2C, member 1
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2000-09-19
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- ATPases Ca2+ transporting
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data