Rabbit ATP2A1 antibody
-
Catalog number70R-6261
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaProteases, Inhibitors, & Enzymes
-
ImmunogenATP2A1 antibody was raised using the N terminal of ATP2A1 corresponding to a region with amino acids MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW
-
SpecificityATP2A1 antibody was raised against the N terminal of ATP2A1
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATP2A1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolATP2A1-AS1, ATP2A1
-
Short nameRabbit ATP2A1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ATP2A1 antibody raised against the N terminal of ATP2A1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetATPase, Ca++ transporting, cardiac muscle, fast twitch 1, ATP2A and SERCA1, ATP2A1 and IDBG-23611 and ENSG00000196296 and 487, metal ion binding, Plasma membranes, Atp2a1 and IDBG-209499 and ENSMUSG00000030730 and 11937, BT.62768 and IDBG-638938 and ENSBTAG00000006541 and 518117
-
Gene info
-
Identity
-
Gene
-
Long gene nameATP2A1 antisense RNA 1
-
GenBank acession
-
Locus
-
Discovery year2014-10-16
-
Entrez gene record
-
RefSeq identity
-
Classification
- Antisense RNAs
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1
-
Synonyms gene
-
Synonyms gene name
- ATPase, Ca++ transporting, cardiac muscle, fast twitch 1
-
Synonyms
-
Synonyms name
-
Locus
-
Discovery year1990-09-10
-
Entrez gene record
-
RefSeq identity
-
Classification
- ATPases Ca2+ transporting
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data