Rabbit ASGR2 antibody
-
Catalog number70R-1145
-
PricePlease ask
-
Size100 ug
-
-
ApplicationsWB, IHC
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenASGR2 antibody was raised using the N terminal of ASGR2 corresponding to a region with amino acids STLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPV
-
SpecificityASGR2 antibody was raised against the N terminal of ASGR2
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ASGR2 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolASGR2
-
Short nameRabbit ASGR2 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ASGR2 antibody raised against the N terminal of ASGR2
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetasialoglycoprotein receptor 2, ASGP-R2 and ASGPR2 and CLEC4H2 and HBXBP and HL-2, ASGR2 and IDBG-23219 and ENSG00000161944 and 433, carbohydrate binding, Plasma membranes, Asgr2 and IDBG-193500 and ENSMUSG00000040963 and 11890, BT.18330 and IDBG-634565 and ENSBTAG00000025101 and 531519
-
Gene info
-
Identity
-
Gene
-
Long gene nameasialoglycoprotein receptor 2
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1988-05-24
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- C-type lectin domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data