Rabbit ARF6 antibody
-
Catalog number70R-5721
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenARF6 antibody was raised using the middle region of ARF6 corresponding to a region with amino acids REMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSG
-
SpecificityARF6 antibody was raised against the middle region of ARF6
-
Cross ReactivityHuman,Mouse,Rat,Drosophila
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ARF6 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolARF6
-
Short nameRabbit ARF6 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ARF6 antibody raised against the middle region of ARF6
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetADP-ribosylation factor 6, ARF6 and IDBG-5864 and ENSG00000165527 and 382, thioesterase binding, nuclei, Arf6 and IDBG-144539 and ENSMUSG00000044147 and 11845, ARF6 and IDBG-648584 and ENSBTAG00000045980 and 100294979
-
Gene info
-
Identity
-
Gene
-
Long gene nameADP ribosylation factor 6
-
Locus
-
Discovery year1994-02-01
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- ARF GTPase family
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data