Rabbit ApoH antibody
-
Catalog number70R-5421
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenApoH antibody was raised using a synthetic peptide corresponding to a region with amino acids LWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGAD
-
SpecificityNA
-
Cross ReactivityHuman,Dog
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of APOH antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolAPOH
-
Short nameRabbit ApoH antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ApoH antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetapolipoprotein H (beta-2-glycoprotein I), B2G1 and B2GP1 and BG, APOH and IDBG-65172 and ENSG00000091583 and 350, lipoprotein lipase activator activity, Extracellular, Apoh and IDBG-213761 and ENSMUSG00000000049 and 11818, APOH and IDBG-643750 and ENSBTAG00000001915 and 281006
-
Gene info
-
Identity
-
Gene
-
Long gene nameapolipoprotein H
-
Synonyms gene
-
Synonyms gene name
- apolipoprotein H (beta-2-glycoprotein I)
-
Synonyms
-
Synonyms name
-
Locus
-
Discovery year1987-09-11
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Sushi domain containing
- Apolipoproteins
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data