Rabbit ANP32A antibody
-
Catalog number70R-1646
-
PricePlease ask
-
Size100 ug
-
-
ApplicationsWB, IHC
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenANP32A antibody was raised using a synthetic peptide corresponding to a region with amino acids MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTI
-
SpecificityNA
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ANP32A antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolANP32A-IT1, ANP32A
-
Short nameRabbit ANP32A antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ANP32A antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Gene info
-
Identity
-
Gene
-
Long gene nameANP32A intronic transcript 1
-
Synonyms gene
-
Synonyms gene name
- chromosome 15 open reading frame 28
- non-protein coding RNA 321
- ANP32A intronic transcript 1 (non-protein coding)
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2004-06-29
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Intronic transcripts
Gene info
-
Identity
-
Gene
-
Long gene nameacidic nuclear phosphoprotein 32 family member A
-
Synonyms gene
-
Synonyms gene name
- acidic (leucine-rich) nuclear phosphoprotein 32 family, member A
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2002-02-13
-
Entrez gene record
-
Pubmed identfication
-
Classification
- INHAT complex
- SET complex
- MicroRNA protein coding host genes
- ANP32 acidic nuclear phosphoproteins
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data