Rabbit ANKRD54 antibody
-
Catalog number70R-4555
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaProtein Modification & Stress Response
-
ImmunogenANKRD54 antibody was raised using the middle region of ANKRD54 corresponding to a region with amino acids EVHALKRLRDSANANDVETVQQLLEDGADPCAADDKGRTALHFASCNGND
-
SpecificityANKRD54 antibody was raised against the middle region of ANKRD54
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ANKRD54 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolANKRD54
-
Short nameRabbit ANKRD54 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ANKRD54 antibody raised against the middle region of ANKRD54
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetankyrin repeat domain 54, ANKRD54 and IDBG-7073 and ENSG00000100124 and 129138, protein complex binding, nuclei, Ankrd54 and IDBG-160669 and ENSMUSG00000033055 and 223690, ANKRD54 and IDBG-641510 and ENSBTAG00000010789 and 538961
-
Gene info
-
Identity
-
Gene
-
Long gene nameankyrin repeat domain 54
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2006-07-06
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Ankyrin repeat domain containing
- MicroRNA protein coding host genes
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data