Rabbit ANGPTL3 antibody

• Catalog number
  70R-4607
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Signal Transduction
• Immunogen
  ANGPTL3 antibody was raised using the N terminal of ANGPTL3 corresponding to a region with amino acids IFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLEL
• Specificity
  ANGPTL3 antibody was raised against the N terminal of ANGPTL3
• Cross Reactivity
  Human,Mouse
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ANGPTL3 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  ANGPTL3  
• Gene symbol
  ANGPTL3
• Short name
  Rabbit ANGPTL3 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal ANGPTL3 antibody raised against the N terminal of ANGPTL3
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  angiopoietin-like 3, ANGPTL3 and IDBG-99367 and ENSG00000132855 and 27329, growth factor activity, Extracellular, Angptl3 and IDBG-166252 and ENSMUSG00000028553 and 30924, ANGPTL3 and IDBG-638594 and ENSBTAG00000021386 and 782603

Gene info

• Identity
  HGNC:491
• Gene
  ANGPTL3
• Long gene name
  angiopoietin like 3
• Synonyms gene
  • ANGPT5
• Synonyms gene name
  • angiopoietin-like 3
• Synonyms name
  • angiopoietin 5
• GenBank acession
  • AF152562
• Locus
  1p31.3
• Discovery year
  2000-02-07
• Entrez gene record
  27329
• Pubmed identfication
  • 10644446
• RefSeq identity
  • NM_014495
• Classification
  • Fibrinogen C domain containing
  • Receptor ligands
  • Angiopoietin like family
• VEGA ID
  OTTHUMG00000009146

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products