Rabbit AMH antibody

• Catalog number
  70R-6224
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Hormones & Steroids
• Immunogen
  AMH antibody was raised using the middle region of AMH corresponding to a region with amino acids SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG
• Specificity
  AMH antibody was raised against the middle region of AMH
• Cross Reactivity
  Human,Mouse,Rat
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AMH antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  AMH  
• Gene symbol
  AMH
• Short name
  Rabbit AMH antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal AMH antibody raised against the middle region of AMH
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  anti-Mullerian hormone, MIF and MIS, AMH and IDBG-15818 and ENSG00000104899 and 100423031,268, growth factor activity, Extracellular, Amh and IDBG-176152 and ENSMUSG00000035262 and 11705, AMH and IDBG-644611 and ENSBTAG00000014955 and 280718

Gene info

• Identity
  HGNC:464
• Gene
  AMH
• Long gene name
  anti-Mullerian hormone
• Synonyms
  • MIS
• GenBank acession
  • K03474
• Locus
  19p13.3
• Discovery year
  1986-01-01
• Entrez gene record
  268
• Pubmed identfication
  • 3754790
  • 18784351
• RefSeq identity
  • NM_000479
• Classification
  • Transforming growth factor beta superfamily
  • MicroRNA protein coding host genes
  • Receptor ligands
• VEGA ID
  OTTHUMG00000180415

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products