Rabbit AGT antibody

  • Catalog number
    70R-6214
  • Price
    Please ask
  • Size
    50 ug
  • Applications
    WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    Hormones & Steroids
  • Immunogen
    AGT antibody was raised using a synthetic peptide corresponding to a region with amino acids IHPFHLVIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQ
  • Specificity
    NA
  • Cross Reactivity
    Human
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AGT antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About
    Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
  • Latin name
    Oryctolagus cuniculus
  • French translation
    anticorps
  • Gene target
    AGT  
  • Gene symbol
    AGT, SLC7A13, AGXT, TRT-AGT3-1, TRT-AGT2-1, TRT-AGT2-2, TRT-AGT1-3, TRT-AGT7-1, TRT-AGT1-1, TRT-AGT1-2
  • Short name
    Rabbit AGT antibody
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Host
    Rabbit, Rabbits
  • Isotype
    NA
  • Alternative name
    Rabbit polyclonal AGT antibody
  • Alternative technique
    antibodies, rabbit-anti
  • Alternative to gene target
    angiotensinogen (serpin peptidase inhibitor, clade A, member 8), ANHU and SERPINA8, AGT and IDBG-107363 and ENSG00000135744 and 183, type 2 angiotensin receptor binding, Extracellular, Agt and IDBG-200169 and ENSMUSG00000031980 and 11606, AGT and IDBG-632058 and ENSBTAG00000012393 and 527114
Gene info
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    trRNA-Thr (anticodon AGT) 3-1
  • Synonyms gene
  • Synonyms gene name
    • transfer RNA threonine 21 (anticodon AGU)
    • transfer RNA-Thr (AGT) 3-1
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2008-08-29
  • Entrez gene record
  • Classification
    • Cytoplasmic transfer RNAs
Gene info
  • Identity
  • Gene
  • Long gene name
    tRNA-Thr (anticodon AGT) 2-1
  • Synonyms gene
  • Synonyms gene name
    • transfer RNA threonine 14 (anticodon AGU)
    • transfer RNA-Thr (AGT) 2-1
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2008-08-29
  • Entrez gene record
  • Classification
    • Cytoplasmic transfer RNAs
Gene info
  • Identity
  • Gene
  • Long gene name
    tRNA-Thr (anticodon AGT) 2-2
  • Synonyms gene
  • Synonyms gene name
    • transfer RNA threonine 15 (anticodon AGU)
    • transfer RNA-Thr (AGT) 2-2
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2008-08-29
  • Entrez gene record
  • Classification
    • Cytoplasmic transfer RNAs
Gene info
  • Identity
  • Gene
  • Long gene name
    tRNA-Thr (anticodon AGT) 1-3
  • Synonyms gene
  • Synonyms gene name
    • transfer RNA threonine 4 (anticodon AGU)
    • transfer RNA-Thr (AGT) 1-3
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2008-08-29
  • Entrez gene record
  • Classification
    • Cytoplasmic transfer RNAs
Gene info
  • Identity
  • Gene
  • Long gene name
    tRNA-Thr (AGT) 7-1
  • Synonyms gene
  • Synonyms gene name
    • tRNA threonine (AGU) 3
    • transfer RNA threonine 3 (anticodon AGU)
    • transfer RNA-Thr (AGT) 7-1
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1993-05-24
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Low confidence cytoplasmic transfer RNAs
Gene info
  • Identity
  • Gene
  • Long gene name
    tRNA-Thr (anticodon AGT) 1-1
  • Synonyms gene
  • Synonyms gene name
    • transfer RNA threonine 8 (anticodon AGU)
    • transfer RNA-Thr (AGT) 1-1
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2008-08-29
  • Entrez gene record
  • Classification
    • Cytoplasmic transfer RNAs
Gene info
  • Identity
  • Gene
  • Long gene name
    tRNA-Thr (anticodon AGT) 1-2
  • Synonyms gene
  • Synonyms gene name
    • transfer RNA threonine 9 (anticodon AGU)
    • transfer RNA-Thr (AGT) 1-2
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2008-08-29
  • Entrez gene record
  • Classification
    • Cytoplasmic transfer RNAs
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee