Rabbit AGGF1 antibody
-
Catalog number70R-3986
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCancer
-
ImmunogenAGGF1 antibody was raised using the middle region of AGGF1 corresponding to a region with amino acids EYEDEKTLKNPKYKDRAGKRREQVGSEGTFQRDDAPASVHSEITDSNKGR
-
SpecificityAGGF1 antibody was raised against the middle region of AGGF1
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AGGF1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolAGGF1
-
Short nameRabbit AGGF1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal AGGF1 antibody raised against the middle region of AGGF1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetangiogenic factor with G patch and FHA domains 1, AGGF1 and IDBG-29861 and ENSG00000164252 and 55109, protein binding, Extracellular, Aggf1 and IDBG-173830 and ENSMUSG00000021681 and 66549, AGGF1 and IDBG-645167 and ENSBTAG00000034823 and 511650
-
Gene info
-
Identity
-
Gene
-
Long gene nameangiogenic factor with G-patch and FHA domains 1
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2004-12-14
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- G-patch domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data