Rabbit ADARB2 antibody
-
Catalog number70R-4957
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDNA & RNA
-
ImmunogenADARB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSADLEIINATTGRRSCG
-
SpecificityNA
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADARB2 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolADARB2, ADARB2-AS1
-
Short nameRabbit ADARB2 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ADARB2 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetadenosine deaminase, RNA-specific, B2, ADAR3 and RED2, ADARB2 and IDBG-45374 and ENSG00000185736 and 105, metal ion binding, nuclei, Adarb2 and IDBG-129047 and ENSMUSG00000052551 and 94191, ADARB2 and IDBG-639585 and ENSBTAG00000014194 and 524061
-
Gene info
-
Identity
-
Gene
-
Long gene nameadenosine deaminase RNA specific B2 (inactive)
-
Synonyms gene name
- adenosine deaminase, RNA-specific, B2 (RED2 homolog rat)
- adenosine deaminase, RNA-specific, B2
- adenosine deaminase, RNA-specific, B2 (non-functional)
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1996-10-02
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Adenosine deaminases acting on RNA
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameADARB2 antisense RNA 1
-
Synonyms gene
-
Synonyms gene name
- chromosome 10 open reading frame 109
- non-protein coding RNA 168
- ADARB2 antisense RNA 1 (non-protein coding)
-
Synonyms
-
Locus
-
Discovery year2004-05-27
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Antisense RNAs
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data