Rabbit ADAM12 antibody
-
Catalog number70R-6059
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaProteases, Inhibitors, & Enzymes
-
ImmunogenADAM12 antibody was raised using a synthetic peptide corresponding to a region with amino acids VELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVE
-
SpecificityNA
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADAM12 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolADAM12
-
Short nameRabbit ADAM12 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ADAM12 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetADAM metallopeptidase domain 12, ADAM12-OT1 and CAR10 and MCMP and MCMPMltna and MLTN and MLTNA, ADAM12 and IDBG-93032 and ENSG00000148848 and 8038, SH3 domain binding, Extracellular, Adam12 and IDBG-211287 and ENSMUSG00000054555 and 11489, BT.29890 and IDBG-640937 and ENSBTAG00000012444 and 407229
-
Gene info
-
Identity
-
Gene
-
Long gene nameADAM metallopeptidase domain 12
-
Synonyms gene name
- a disintegrin and metalloproteinase domain 12 (meltrin alpha)
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1998-12-01
-
Entrez gene record
-
Pubmed identfication
-
Classification
- ADAM metallopeptidase domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data