Rabbit ADAD2 antibody
-
Catalog number70R-4921
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDNA & RNA
-
ImmunogenADAD2 antibody was raised using the C terminal of ADAD2 corresponding to a region with amino acids TPDTCRGLSLNWSLGDPGIEVVDVATGRVKANAALGPPSRLCKASFLRAF
-
SpecificityADAD2 antibody was raised against the C terminal of ADAD2
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADAD2 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolADAD2
-
Short nameRabbit ADAD2 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ADAD2 antibody raised against the C terminal of ADAD2
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetadenosine deaminase domain containing 2, ADAD2 and IDBG-44468 and ENSG00000140955 and 161931, adenosine deaminase activity, multiple, Adad2 and IDBG-195690 and ENSMUSG00000024266 and 75773, ADAD2 and IDBG-629790 and ENSBTAG00000034283 and
-
Gene info
-
Identity
-
Gene
-
Long gene nameadenosine deaminase domain containing 2
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2007-05-31
-
Entrez gene record
-
RefSeq identity
-
Classification
- Adenosine deaminases acting on RNA
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data