Rabbit ACVR1C antibody
#
-
Catalog number70R-7481
-
Price:
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenACVR1C antibody was raised using the N terminal of ACVR1C corresponding to a region with amino acids QVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPMELAIIITVP
-
SpecificityACVR1C antibody was raised against the N terminal of ACVR1C
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACVR1C antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolACVR1C
-
Short nameRabbit ACVR1C antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ACVR1C antibody raised against the N terminal of ACVR1C
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetactivin A receptor, type IC, ACVR1C and IDBG-72896 and ENSG00000123612 and 130399, activin receptor activity, Plasma membranes, Acvr1c and IDBG-172013 and ENSMUSG00000026834 and 269275, ACVR1C and IDBG-641609 and ENSBTAG00000019337 and 536380
-
Gene info
-
Identity
-
Gene
-
Long gene nameactivin A receptor type 1C
-
Synonyms gene name
- activin A receptor, type IC
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2003-07-21
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Type 1 receptor serine/threonine kinases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data