Rabbit ACVR1 antibody

• Catalog number
  70R-7303
• Price
  Please ask
• Size
  50 ug

• Applications
  WB, IHC
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Signal Transduction
• Immunogen
  ACVR1 antibody was raised using the N terminal of ACVR1 corresponding to a region with amino acids TCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIIL
• Specificity
  ACVR1 antibody was raised against the N terminal of ACVR1
• Cross Reactivity
  Human,Mouse
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACVR1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  ACVR1  
• Gene symbol
  ACVR1
• Short name
  Rabbit ACVR1 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal ACVR1 antibody raised against the N terminal of ACVR1
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  activin A receptor, type I, ACTRI and ACVR1A and ACVRLK2 and ALK2 and FOP and SKR1 and TSRI, ACVR1 and IDBG-72930 and ENSG00000115170 and 90, transforming growth factor beta receptor activity, Plasma membranes, Acvr1 and IDBG-172102 and ENSMUSG00000026836 and 11477, ACVR1 and IDBG-641620 and ENSBTAG00000011909 and 338068

Gene info

• Identity
  HGNC:171
• Gene
  ACVR1
• Long gene name
  activin A receptor type 1
• Synonyms gene
  • ACVRLK2
• Synonyms gene name
  • activin A receptor, type I
• Synonyms
  • SKR1
  • ALK2
  • ACVR1A
• Locus
  2q24.1
• Discovery year
  1994-01-10
• Entrez gene record
  90
• Pubmed identfication
  • 8397373
• RefSeq identity
  • NM_001105
• Classification
  • Type 1 receptor serine/threonine kinases
• VEGA ID
  OTTHUMG00000131967

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products