Rabbit ACSL4 antibody

• Catalog number
  70R-7155
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Proteases, Inhibitors, & Enzymes
• Immunogen
  ACSL4 antibody was raised using the N terminal of ACSL4 corresponding to a region with amino acids AKRIKAKPTSDKPGSPYRSVTHFDSLAVIDIPGADTLDKLFDHAVSKFGK
• Specificity
  ACSL4 antibody was raised against the N terminal of ACSL4
• Cross Reactivity
  Human,Mouse,Rat
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACSL4 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  ACSL4  
• Gene symbol
  ACSL4
• Short name
  Rabbit ACSL4 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal ACSL4 antibody raised against the N terminal of ACSL4
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  acyl-CoA synthetase long-chain family member 4, ACS4 and FACL4 and LACS4 and MRX63 and MRX68, ACSL4 and IDBG-82250 and ENSG00000068366 and 2182, arachidonate-CoA ligase activity, Plasma membranes, Acsl4 and IDBG-176201 and ENSMUSG00000031278 and 50790, ACSL4 and IDBG-634542 and ENSBTAG00000018986 and 536628

Gene info

• Identity
  HGNC:3571
• Gene
  ACSL4
• Long gene name
  acyl-CoA synthetase long chain family member 4
• Synonyms gene
  • FACL4
  • MRX63
  • MRX68
• Synonyms gene name
  • fatty-acid-Coenzyme A ligase, long-chain 4
  • mental retardation, X-linked 63
  • mental retardation, X-linked 68
• Synonyms
  • ACS4
  • LACS4
• Synonyms name
  • lignoceroyl-CoA synthase
  • long-chain fatty-acid-Coenzyme A ligase 4
• GenBank acession
  • BC034959
• Locus
  Xq23
• Discovery year
  1997-05-09
• Entrez gene record
  2182
• Pubmed identfication
  • 9480748
  • 12949969
• RefSeq identity
  • NM_004458
• Classification
  • Acyl-CoA synthetase family
• VEGA ID
  OTTHUMG00000022190
• Locus Specific Databases
  • Global Variome shared LOVD

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products