Rabbit AChE antibody
-
Catalog number70R-6077
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaNeuroscience
-
ImmunogenAChE antibody was raised using a synthetic peptide corresponding to a region with amino acids SMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSV
-
SpecificityNA
-
Cross ReactivityHuman, Mouse, Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACHE antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolACHE, COLQ
-
Short nameRabbit AChE antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal AChE antibody Yt blood group
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetacetylcholinesterase, ACEE and ARACHE and N-ACHE and YT, ACHE and IDBG-32513 and ENSG00000087085 and 43, protein self-association, nuclei, Ache and IDBG-204838 and ENSMUSG00000023328 and 11423, ACHE and IDBG-640435 and ENSBTAG00000001139 and 540446
-
Gene info
-
Identity
-
Gene
-
Long gene nameacetylcholinesterase (Cartwright blood group)
-
Synonyms gene
-
Synonyms gene name
- acetylcholinesterase (YT blood group)
- acetylcholinesterase (Yt blood group)
-
Synonyms name
-
Locus
-
Discovery year1989-06-02
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Blood group antigens
-
VEGA ID
-
Locus Specific Databases
Gene info
-
Identity
-
Gene
-
Long gene namecollagen like tail subunit of asymmetric acetylcholinesterase
-
Synonyms gene name
- collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1998-09-14
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- MicroRNA protein coding host genes
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data