Rabbit ACCN4 antibody

• Catalog number
  70R-5090
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Cell Biology
• Immunogen
  ACCN4 antibody was raised using the N terminal of ACCN4 corresponding to a region with amino acids SPSSRGQMPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAVAPGAAPRDLA
• Specificity
  ACCN4 antibody was raised against the N terminal of ACCN4
• Cross Reactivity
  Human,Mouse,Rat,Dog
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACCN4 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  ACCN4  
• Gene symbol
  ASIC4
• Short name
  Rabbit ACCN4 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal ACCN4 antibody raised against the N terminal of ACCN4
• Alternative technique
  antibodies, rabbit-anti

Gene info

• Identity
  HGNC:21263
• Gene
  ASIC4
• Long gene name
  acid sensing ion channel subunit family member 4
• Synonyms gene
  • ACCN4
• Synonyms gene name
  • amiloride-sensitive cation channel 4, pituitary
  • acid-sensing (proton-gated) ion channel family member 4
  • acid sensing ion channel family member 4
• Synonyms
  • BNAC4
• GenBank acession
  • AJ271643
• Locus
  2q35
• Discovery year
  2003-06-05
• Entrez gene record
  55515
• Pubmed identfication
  • 10852210
• RefSeq identity
  • NM_018674
• Classification
  • Acid sensing ion channel subunits
• VEGA ID
  OTTHUMG00000058928

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products