PTGER3 antibody

Category

Primary Antibody
Antibody Subtype

Polyclonal Antibodies, Purified
Area of research

Signal Transduction
Type of Immunogen

PTGER3 antibodies were raised using a synthetic peptide corresponding to a region with amino acids ILDPWVYLLLRKILLRKFCQIRYHTNNYASSSTSLPCQCSSTLMWSDHLE
Raised in

Rabbit
Cross Reactivity

Human
Method of Purification

Affinity purified
Concentration

1 mg/ml
Form Buffer

Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PTGER3 antibody in PBS
Storage

Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Shipping conditions

Blue Ice
Tested for

WB
Usage Recommendations

WB: 1 ug/ml
Assay Information

PTGER3 Blocking Peptide, catalog no. 33R-4041, is also available for use as a blocking control in assays to test for specificity of this PTGER3 antibody
Additional Information

This is a rabbit polyclonal antibody against PTGER3, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
URL
More info
Properties

If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
French translation

anticorps

Gene target

PTGER3
Gene symbol

PTGER3
Short name

PTGER3 antibody
Technique

Antibody, antibodies against human proteins, antibodies for
Alternative name

Rabbit polyclonal PTGER3 antibody
Alternative technique

antibodies
Alternative to gene target

prostaglandin E receptor 3 (subtype EP3), EP3 and EP3-I and EP3-II and EP3-III and EP3-IV and EP3e and PGE2-R, PTGER3 and IDBG-99662 and ENSG00000050628 and 5733, protein binding, nuclei, Ptger3 and IDBG-201070 and ENSMUSG00000040016 and 19218, PTGER3 and IDBG-637924 and ENSBTAG00000019230 and 282330

Name

Blotting, Western
Concept

Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
Qualifiers

ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data