PSMD12 antibody

• Catalog number
  70R-4479
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Protein Modification & Stress Response
• Type of Immunogen
  PSMD12 antibodies were raised using a synthetic peptide corresponding to a region with amino acids KYKDLLKLFTTMELMRWSTLVEDYGMELRKGSLESPATDVFGSTEEGEKR
• Raised in
  Rabbit
• Cross Reactivity
  Human
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSMD12 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  PSMD12 Blocking Peptide, catalog no. 33R-4742, is also available for use as a blocking control in assays to test for specificity of this PSMD12 antibody
• Additional Information
  This is a rabbit polyclonal antibody against PSMD12, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  PSMD12  
• Gene symbol
  PSMD12
• Short name
  PSMD12 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal PSMD12 antibody
• Alternative technique
  antibodies
• Alternative to gene target
  proteasome (prosome, macropain) 26S subunit, non-ATPase, 12, p55 and Rpn5, PSMD12 and IDBG-65421 and ENSG00000197170 and 5718, protein binding, nuclei, Psmd12 and IDBG-213692 and ENSMUSG00000020720 and 66997, PSMD12 and IDBG-641972 and ENSBTAG00000002423 and 538204

Gene info

• Identity
  HGNC:9557
• Gene
  PSMD12
• Long gene name
  proteasome 26S subunit, non-ATPase 12
• Synonyms gene name
  • proteasome (prosome, macropain) 26S subunit, non-ATPase, 12
• Synonyms
  • p55
  • Rpn5
• GenBank acession
  • AB003103
• Locus
  17q24.2
• Discovery year
  1997-02-19
• Entrez gene record
  5718
• Pubmed identfication
  • 9426256
• RefSeq identity
  • NM_002816
  • NM_174871
• Classification
  • Proteasome
• VEGA ID
  OTTHUMG00000140376

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products