PSMB9 antibody

• Catalog number
  70R-5740
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Protein Modification & Stress Response
• Type of Immunogen
  PSMB9 antibodies were raised using the C terminal of PSMB9 corresponding to a region with amino acids RRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE
• Raised in
  Rabbit
• Specificity
  PSMB9 antibody was raised against the C terminal of PSMB9
• Cross Reactivity
  Human
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSMB9 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  PSMB9 Blocking Peptide, catalog no. 33R-8138, is also available for use as a blocking control in assays to test for specificity of this PSMB9 antibody
• Additional Information
  This is a rabbit polyclonal antibody against PSMB9, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  PSMB9  
• Gene symbol
  PSMB9
• Short name
  PSMB9 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal PSMB9 antibody raised against the C terminal of PSMB9
• Alternative technique
  antibodies
• Alternative to gene target
  proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2), beta1i and LMP2 and PSMB6i and RING12, PSMB9 and IDBG-403299 and ENSG00000240065 and 5698, protein binding, nuclei, Psmb9 and IDBG-705306 and ENSMUSG00000096727 and 16912, PSMB9 and IDBG-628867 and ENSBTAG00000008954 and 510593

Gene info

• Identity
  HGNC:9546
• Gene
  PSMB9
• Long gene name
  proteasome 20S subunit beta 9
• Synonyms gene
  • LMP2
• Synonyms gene name
  • proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional protease 2)
  • large multifunctional peptidase 2
  • proteasome (prosome, macropain) subunit, beta type, 9
  • proteasome subunit beta 9
• Synonyms
  • RING12
  • beta1i
  • PSMB6i
• Synonyms name
  • proteasome subunit β1i
• Locus
  6p21.32
• Discovery year
  1991-12-18
• Entrez gene record
  5698
• Pubmed identfication
  • 1922385
  • 1529427
• RefSeq identity
  • NM_002800
• Classification
  • Proteasome
• VEGA ID
  OTTHUMG00000031287

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products