PNN antibody

• Catalog number
  70R-6054
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Cell Biology
• Type of Immunogen
  PNN antibodies were raised using the N terminal of PNN corresponding to a region with amino acids MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGP
• Raised in
  Rabbit
• Specificity
  PNN antibody was raised against the N terminal of PNN
• Cross Reactivity
  Human,Mouse,Rat,Dog
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PNN antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  PNN Blocking Peptide, catalog no. 33R-5794, is also available for use as a blocking control in assays to test for specificity of this PNN antibody
• Additional Information
  This is a rabbit polyclonal antibody against PNN, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  PNN  
• Gene symbol
  PNN
• Short name
  PNN antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal PNN antibody raised against the N terminal of PNN
• Alternative technique
  antibodies
• Alternative to gene target
  pinin, desmosome associated protein, DRS and DRSP and memA and SDK3, PNN and IDBG-5267 and ENSG00000100941 and 5411, poly(A) RNA binding, nuclei, Pnn and IDBG-142057 and ENSMUSG00000020994 and 18949, PNN and IDBG-632802 and ENSBTAG00000026995 and 100296970

Gene info

• Identity
  HGNC:9162
• Gene
  PNN
• Long gene name
  pinin, desmosome associated protein
• Synonyms
  • memA
• GenBank acession
  • U77718
• Locus
  14q21.1
• Discovery year
  1997-12-10
• Entrez gene record
  5411
• Pubmed identfication
  • 8922384
• RefSeq identity
  • NM_002687
• VEGA ID
  OTTHUMG00000028821

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products