PAFAH1B1 antibody

• Catalog number
  70R-5659
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Neuroscience
• Type of Immunogen
  PAFAH1B1 antibodies were raised using the N terminal of PAFAH1B1 corresponding to a region with amino acids MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGL
• Raised in
  Rabbit
• Specificity
  PAFAH1B1 antibody was raised against the N terminal of PAFAH1B1
• Cross Reactivity
  Human,Mouse,Rat
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PAFAH1B1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  PAFAH1B1 Blocking Peptide, catalog no. 33R-6595, is also available for use as a blocking control in assays to test for specificity of this PAFAH1B1 antibody
• Additional Information
  This is a rabbit polyclonal antibody against PAFAH1B1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  PAFAH1B1  
• Gene symbol
  PAFAH1B1
• Short name
  PAFAH1B1 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal PAFAH1B1 antibody raised against the N terminal of PAFAH1B1
• Alternative technique
  antibodies
• Alternative to gene target
  platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa), LIS1 and LIS2 and MDCR and MDS and PAFAH, PAFAH1B1 and IDBG-16417 and ENSG00000007168 and 5048, phosphoprotein binding, nuclei, Pafah1b1 and IDBG-198862 and ENSMUSG00000020745 and 18472, PAFAH1B1 and IDBG-633101 and ENSBTAG00000016806 and 282513

Gene info

• Identity
  HGNC:8574
• Gene
  PAFAH1B1
• Long gene name
  platelet activating factor acetylhydrolase 1b regulatory subunit 1
• Synonyms gene
  • MDCR
  • MDS
• Synonyms gene name
  • platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit (45kD)
  • Miller-Dieker syndrome chromosome region
  • platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit 45kDa
  • platelet-activating factor acetylhydrolase, isoform Ib, subunit 1 (45kDa)
  • platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa)
• Synonyms
  • LIS1
  • PAFAH
  • NudF
• Synonyms name
  • lissencephaly-1
• GenBank acession
  • L25107
• Locus
  17p13.3
• Discovery year
  1998-04-03
• Entrez gene record
  5048
• Pubmed identfication
  • 8355785
  • 9063735
• RefSeq identity
  • NM_000430
• Classification
  • WD repeat domain containing
• VEGA ID
  OTTHUMG00000177574

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products