NR4A1 antibody

• Catalog number
  70R-1931
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Cell Biology
• Type of Immunogen
  NR4A1 antibodies were raised using the middle region of NR4A1 corresponding to a region with amino acids FQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHL
• Raised in
  Rabbit
• Specificity
  NR4A1 antibody was raised against the middle region of NR4A1
• Cross Reactivity
  Human,Dog
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NR4A1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  NR4A1 Blocking Peptide, catalog no. 33R-3032, is also available for use as a blocking control in assays to test for specificity of this NR4A1 antibody
• Additional Information
  This is a rabbit polyclonal antibody against NR4A1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  NR4A1  
• Gene symbol
  NR4A1AS, NR4A1
• Short name
  NR4A1 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal NR4A1 antibody raised against the middle region of NR4A1
• Alternative technique
  antibodies
• Alternative to gene target
  nuclear receptor subfamily 4, group A, member 1, GFRP1 and HMR and N10 and NAK-1 and NGFIB and NP10 and NUR77 and TR3, NR4A1 and IDBG-33982 and ENSG00000123358 and 3164, protein heterodimerization activity, nuclei, Nr4a1 and IDBG-185628 and ENSMUSG00000023034 and 15370, NR4A1 and IDBG-632090 and ENSBTAG00000000507 and 528390

Gene info

• Identity
  HGNC:54409
• Gene
  NR4A1AS
• Long gene name
  NR4A1 antisense RNA
• Synonyms
  • NR4A1-AS1
• Locus
  12q13.13
• Discovery year
  2019-07-11
• Pubmed identfication
  • 31253658
• Classification
  • Long non-coding RNAs with non-systematic symbols

Gene info

• Identity
  HGNC:7980
• Gene
  NR4A1
• Long gene name
  nuclear receptor subfamily 4 group A member 1
• Synonyms gene
  • HMR
  • GFRP1
• Synonyms gene name
  • nuclear receptor subfamily 4, group A, member 1
• Synonyms
  • TR3
  • N10
  • NAK-1
  • NGFIB
  • NUR77
• GenBank acession
  • L13740
• Locus
  12q13.13
• Discovery year
  1990-09-10
• Entrez gene record
  3164
• Pubmed identfication
  • 2626032
• Classification
  • Nuclear receptor subfamily 4 group A
• VEGA ID
  OTTHUMG00000150393

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products