Nfkbiz Blocking Peptide

• Catalog number
  33R-9778
• Price
  Please ask
• Size
  100 µg

• Category
  Proteins
• Antibody Subtype
  Blocking Peptides
• Area of research
  Signal Transduction
• Residues
  VRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKGKSIQQRAPPY
• Type of protein
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB; IHC
• URL
• More info
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  Nfkbiz  
• Gene symbol
  NFKBIZ
• Short name
  Nfkbiz Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  A synthetic peptide for use as a blocking control in assays to test for specificity of Nfkbiz antibody, catalog no. 70R-9519
• Alternative technique
  control, peptides
• Alternative to gene target
  nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, zeta, NFKBIZ and IDBG-48252 and ENSG00000144802 and 64332, protein binding, nuclei, Nfkbiz and IDBG-165943 and ENSMUSG00000035356 and 80859, NFKBIZ and IDBG-631581 and ENSBTAG00000010987 and 282713

Gene info

• Identity
  HGNC:29805
• Gene
  NFKBIZ
• Long gene name
  NFKB inhibitor zeta
• Synonyms gene name
  • nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, zeta
• Synonyms
  • MAIL
  • FLJ34463
  • INAP
• Synonyms name
  • IL-1 inducible nuclear ankyrin-repeat protein
  • NF-kappa-B inhibitor zeta
• GenBank acession
  • AF548362
• Locus
  3q12.3
• Discovery year
  2004-09-29
• Entrez gene record
  64332
• Pubmed identfication
  • 12565889
  • 16513645
• RefSeq identity
  • NM_031419
• Classification
  • Ankyrin repeat domain containing
• VEGA ID
  OTTHUMG00000159194

Similar products