NDUFS3 antibody

• Catalog number
  70R-5325
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Proteases, Inhibitors, & Enzymes
• Type of Immunogen
  NDUFS3 antibodies were raised using the middle region of NDUFS3 corresponding to a region with amino acids EVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK
• Raised in
  Rabbit
• Specificity
  NDUFS3 antibody was raised against the middle region of NDUFS3
• Cross Reactivity
  Human,Mouse
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NDUFS3 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  NDUFS3 Blocking Peptide, catalog no. 33R-2797, is also available for use as a blocking control in assays to test for specificity of this NDUFS3 antibody
• Additional Information
  This is a rabbit polyclonal antibody against NDUFS3, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  NDUFS3  
• Gene symbol
  NDUFS3
• Short name
  NDUFS3 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal NDUFS3 antibody raised against the middle region of NDUFS3
• Alternative technique
  antibodies
• Alternative to gene target
  NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa (NADH-coenzyme Q reductase), CI-30, NDUFS3 and IDBG-239864 and ENSG00000213619 and 4722, oxidoreductase activity, nuclei, Ndufs3 and IDBG-189838 and ENSMUSG00000005510 and 68349, NDUFS3 and IDBG-637482 and ENSBTAG00000018483 and 287327

Gene info

• Identity
  HGNC:7710
• Gene
  NDUFS3
• Long gene name
  NADH:ubiquinone oxidoreductase core subunit S3
• Synonyms gene name
  • NADH dehydrogenase (ubiquinone) Fe-S protein 3 (30kD) (NADH-coenzyme Q reductase)
  • NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa (NADH-coenzyme Q reductase)
• Synonyms
  • CI-30
• Synonyms name
  • complex I 30kDa subunit
  • NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
• GenBank acession
  • AF067139
• Locus
  11p11.2
• Discovery year
  1995-11-08
• Entrez gene record
  4722
• Pubmed identfication
  • 9763677
• RefSeq identity
  • NM_004551
• Classification
  • NADH:ubiquinone oxidoreductase core subunits
• VEGA ID
  OTTHUMG00000166893

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products