NCAPH antibody
-
Catalog number70R-5519
-
PricePlease ask
-
Size50 µg
-
-
CategoryPrimary Antibody
-
Antibody SubtypePolyclonal Antibodies, Purified
-
Area of researchDNA & RNA
-
Type of ImmunogenNCAPH antibodies were raised using the N terminal of NCAPH corresponding to a region with amino acids MPLPRKAPLNIPGTPVLEDFPQNDDEKERLQRRRSRVFDLQFSTDSPRLL
-
Raised inRabbit
-
SpecificityNCAPH antibody was raised against the N terminal of NCAPH
-
Cross ReactivityHuman,Mouse,Rat
-
Method of PurificationAffinity purified
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NCAPH antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping conditionsBlue Ice
-
Tested forWB
-
Usage RecommendationsWB: 1 ug/ml
-
Assay InformationNCAPH Blocking Peptide, catalog no. 33R-6292, is also available for use as a blocking control in assays to test for specificity of this NCAPH antibody
-
Additional InformationThis is a rabbit polyclonal antibody against NCAPH, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolNCAPH
-
Short nameNCAPH antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative nameRabbit polyclonal NCAPH antibody raised against the N terminal of NCAPH
-
Alternative techniqueantibodies
-
Gene info
-
Identity
-
Gene
-
Long gene namenon-SMC condensin I complex subunit H
-
Synonyms gene
-
Synonyms gene name
- barren (Drosophila) homolog
- barren homolog (Drosophila)
- barren homolog 1 (Drosophila)
- non-SMC condensin I complex, subunit H
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1998-02-11
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Condensin I subunits
- Kleisins
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data