Mouse Integrin alpha 3A antibody

  • Catalog number
    10R-8071
  • Price
    Please ask
  • Size
    100 ug
  • Applications
    IHC, IHC-F, WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Monoclonal Antibodies
  • Research Area
    Signal Transduction
  • Immunogen
    Integrin alpha 3A antibody was raised in Mouse using a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin as the immunogen.
  • Specificity
    Reacts exclusively with the cytoplasmic domain of non-phosphorylated integrin subunit a3A
  • Cross Reactivity
    Human
  • Clone
    158A3
  • Concentration
    NA
  • Form Buffer
    Supplied in PBS containing 0.09% sodium azide
  • Storage
    NA
  • Shipping Info
    NA
  • Description
    The Mouse Integrin alpha 3A antibody is a α- or alpha protein sometimes glycoprotein present in blood.
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • French translation
    anticorps
  • Gene target
    Integrin   alpha  
  • Short name
    Mouse Integrin alpha 3A antibody
  • Technique
    Antibody, Mouse, antibodies against human proteins, antibodies for, mouses
  • Host
    Mouse
  • Isotype
    IgG2a
  • Species
    Mouse, Mouses
  • Alternative name
    Mouse monoclonal Integrin alpha 3A antibody
  • Alternative technique
    antibodies, murine
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee