Influenza Virus Ns1A Binding Protein Blocking Peptide

  • Catalog number
    33R-7827
  • Price
    Please ask
  • Size
    100 ug
  • Product Type
    Proteins
  • Product Subtype
    Blocking Peptides
  • Research Area
    Infectious Disease
  • Tag Conjugate
    RAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLK
  • Type1
    Synthetic
  • Form Buffer
    Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
  • Storage
    Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
  • Applications
    WB, IHC
  • Shipping Info
    Blue Ice
  • Test
    You can block the antibody by the specific target amino acid sequence of peptide.
  • Properties
    blocking peptide
  • Description
    Influenza A and B H1N1 H3N2 Hemagglutinin-nucleoprotein recombinant proteins, peptides and antibodies detect a virus commonly known as "the flu". Influenza is an infectious disease caused by an influenza virus. Symptoms can be mild to severe. The most common symptoms include a high fever, runny nose, sore throat, muscle pains, headache, coughing, and feeling tired. These symptoms typically begin two days after exposure to the virus and most last less than a week. The cough, however, may last for more than two weeks. In children, there may be nausea and vomiting, but these are not common in adults. Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
  • Gene target
  • Gene symbol
    IVNS1ABP
  • Short name
    Influenza Virus Ns1A Binding Protein Blocking Peptide
  • Technique
    blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
  • Species
    Virus, Influenza, Viruses
  • Alternative name
    Influenza Virus Ns1A Binding Protein inhibiting short protein sequence
  • Alternative technique
    control, peptides
  • Virus
    influenza
Gene info
Similar products
Filters
Contact
Chat with gentaur.com employee