IHH antibody

• Catalog number
  70R-1733
• Price
  Please ask
• Size
  100 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Signal Transduction
• Type of Immunogen
  IHH antibodies were raised using a synthetic peptide corresponding to a region with amino acids AAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIAR
• Raised in
  Rabbit
• Cross Reactivity
  Human,Mouse,Rat
• Method of Purification
  Total IgG Protein A purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of IHH antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB; IHC
• Usage Recommendations
  WB: 1.25 ug/ml; IHC: 4-8 ug/ml
• Assay Information
  IHH Blocking Peptide, catalog no. 33R-1064, is also available for use as a blocking control in assays to test for specificity of this IHH antibody
• Additional Information
  This is a rabbit polyclonal antibody against IHH. It was validated on Western Blot and immunohistochemistry. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  IHH  
• Gene symbol
  IHH
• Short name
  IHH antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal IHH antibody
• Alternative technique
  antibodies
• Alternative to gene target
  Indian hedgehog, BDA1 and HHG2, IHH and IDBG-81274 and ENSG00000163501 and 3549, peptidase activity, Extracellular, Ihh and IDBG-169082 and ENSMUSG00000006538 and 16147, BT.22104 and IDBG-643926 and ENSBTAG00000008452 and 522714

Gene info

• Identity
  HGNC:5956
• Gene
  IHH
• Long gene name
  Indian hedgehog signaling molecule
• Synonyms gene name
  • Indian hedgehog (Drosophila) homolog
• Synonyms
  • HHG2
  • BDA1
• GenBank acession
  • L38517
• Locus
  2q35
• Discovery year
  1995-03-21
• Entrez gene record
  3549
• Pubmed identfication
  • 7590746
  • 14770182
• RefSeq identity
  • NM_002181
• Classification
  • Hedgehog signaling molecule family
  • MicroRNA protein coding host genes
• VEGA ID
  OTTHUMG00000154631

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products