Growth Hormone 2 antibody

• Catalog number
  70R-1713
• Price
  Please ask
• Size
  100 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Cytokines & Growth Factors
• Type of Immunogen
  Growth Hormone 2 antibodies were raised using the middle region of GH2 corresponding to a region with amino acids NQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSC
• Raised in
  Rabbit
• Specificity
  Growth Hormone 2 antibody was raised against the middle region of GH2
• Cross Reactivity
  Human
• Method of Purification
  Total IgG Protein A purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of GH2 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 5 ug/ml
• Assay Information
  Growth Hormone 2 Blocking Peptide, catalog no. 33R-6848, is also available for use as a blocking control in assays to test for specificity of this Growth Hormone 2 antibody
• Additional Information
  This is a rabbit polyclonal antibody against GH2, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• Description
  Hormone releasing factors and releasing hormones are  signaling molecules produced by glands in multicellular organisms. The glands that secrete Luteinizing hormones LHRG and LH, FSH comprise the endocrine signaling system. The term growth hormone releasing hormone GHRH is sometimes extended to include chemicals produced by cells that affect the same cell (autocrine or intracrine signaling) or nearby cells (paracrine signaling). Human recombinant LHRG and GHRH are produced in E. coli or in yeast cells.
• French translation
  anticorps

• Gene target
  Growth   Hormone  
• Gene symbol
  GH2
• Short name
  Growth Hormone 2 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal Growth Hormone 2 antibody raised against the middle region of GH2
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:4262
• Gene
  GH2
• Long gene name
  growth hormone 2
• Synonyms
  • GH-V
  • GHV
  • GHL
  • hGH-V
• Synonyms name
  • placental-specific growth hormone
  • placenta-specific growth hormone
• GenBank acession
  • J03756
• Locus
  17q23.3
• Discovery year
  2001-06-22
• Entrez gene record
  2689
• Pubmed identfication
  • 6306568
• RefSeq identity
  • NM_002059
• Classification
  • Growth hormone family
• VEGA ID
  OTTHUMG00000172284

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products