GNAI2 antibody

• Catalog number
  70R-5719
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  DNA & RNA
• Type of Immunogen
  GNAI2 antibodies were raised using a synthetic peptide corresponding to a region with amino acids EYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDL
• Raised in
  Rabbit
• Cross Reactivity
  Human,Mouse,Rat,Dog
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GNAI2 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  GNAI2 Blocking Peptide, catalog no. 33R-2827, is also available for use as a blocking control in assays to test for specificity of this GNAI2 antibody
• Additional Information
  This is a rabbit polyclonal antibody against GNAI2, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  GNAI2  
• Gene symbol
  GNAI2
• Short name
  GNAI2 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal GNAI2 antibody
• Alternative technique
  antibodies
• Alternative to gene target
  guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2, GIP and GNAI2B and H_LUCA15.1 and H_LUCA16.1, GNAI2 and IDBG-36105 and ENSG00000114353 and 2771, metal ion binding, nuclei, Gnai2 and IDBG-198032 and ENSMUSG00000032562 and 14678, GNAI2 and IDBG-645836 and ENSBTAG00000020645 and 281791

Gene info

• Identity
  HGNC:4385
• Gene
  GNAI2
• Long gene name
  G protein subunit alpha i2
• Synonyms gene
  • GNAI2B
• Synonyms gene name
  • guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2
• Synonyms
  • GIP
• Synonyms name
  • GTP-binding regulatory protein Gi alpha-2 chain
• GenBank acession
  • X04828
• Locus
  3p21.31
• Discovery year
  1986-01-01
• Entrez gene record
  2771
• Pubmed identfication
  • 3100330
  • 1733849
• RefSeq identity
  • NM_002070
• Classification
  • G protein subunits alpha, group i
  • MicroRNA protein coding host genes
• VEGA ID
  OTTHUMG00000156940

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products