FXR1 antibody

• Catalog number
  70R-5038
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Neuroscience
• Type of Immunogen
  FXR1 antibodies were raised using the C terminal of FXR1 corresponding to a region with amino acids EQLRQIGSRSYSGRGRGRRGPNYTSGYGTNSELSNPSETESERKDELSDW
• Raised in
  Rabbit
• Specificity
  FXR1 antibody was raised against the C terminal of FXR1
• Cross Reactivity
  Human,Mouse,Rat,Dog
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FXR1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 0.25 ug/ml
• Assay Information
  FXR1 Blocking Peptide, catalog no. 33R-2671, is also available for use as a blocking control in assays to test for specificity of this FXR1 antibody
• Additional Information
  This is a rabbit polyclonal antibody against FXR1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  FXR1  
• Gene symbol
  FXR1
• Short name
  FXR1 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal FXR1 antibody raised against the C terminal of FXR1
• Alternative technique
  antibodies
• Alternative to gene target
  fragile X mental retardation, autosomal homolog 1, FXR1P, FXR1 and IDBG-66609 and ENSG00000114416 and 8087, poly(A) RNA binding, nuclei, Fxr1 and IDBG-137735 and ENSMUSG00000027680 and 14359, FXR1 and IDBG-635881 and ENSBTAG00000016457 and 536793

Gene info

• Identity
  HGNC:4023
• Gene
  FXR1
• Long gene name
  FMR1 autosomal homolog 1
• Synonyms gene name
  • fragile X mental retardation, autosomal homolog 1
• GenBank acession
  • M67468
• Locus
  3q26.33
• Discovery year
  1999-04-16
• Entrez gene record
  8087
• Pubmed identfication
  • 7781595
  • 9642279
• VEGA ID
  OTTHUMG00000158138

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products