FKBP5 Blocking Peptide

• Catalog number
  33R-1834
• Price
  Please ask
• Size
  100 µg

• Category
  Proteins
• Antibody Subtype
  Blocking Peptides
• Area of research
  Signal Transduction
• Residues
  CYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFE
• Type of protein
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB; IHC
• URL
• More info
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  FKBP5  
• Gene symbol
  FKBP5
• Short name
  FKBP5 Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  A synthetic peptide for use as a blocking control in assays to test for specificity of FKBP5 antibody, catalog no. 70R-2377
• Alternative technique
  control, peptides
• Alternative to gene target
  FK506 binding protein 5, AIG6 and FKBP51 and FKBP54 and P54 and PPIase and Ptg-10, FKBP5 and IDBG-84259 and ENSG00000096060 and 2289, heat shock protein binding, nuclei, Fkbp5 and IDBG-158514 and ENSMUSG00000024222 and 14229, FKBP5 and IDBG-629966 and ENSBTAG00000047502 and 535704

Gene info

• Identity
  HGNC:3721
• Gene
  FKBP5
• Long gene name
  FKBP prolyl isomerase 5
• Synonyms gene name
  • FK506-binding protein 5
  • FK506 binding protein 5
• Synonyms
  • FKBP51
  • FKBP54
  • PPIase
  • P54
  • Ptg-10
• GenBank acession
  • U42031
• Locus
  6p21.31
• Discovery year
  1997-06-09
• Entrez gene record
  2289
• Pubmed identfication
  • 9001212
• Classification
  • Tetratricopeptide repeat domain containing
  • FKBP prolyl isomerases
  • MicroRNA protein coding host genes
• VEGA ID
  OTTHUMG00000014576

Similar products