FANCA antibody

• Catalog number
  70R-3337
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Immunology
• Type of Immunogen
  FANCA antibodies were raised using the N terminal of FANCA corresponding to a region with amino acids KLSLSKVIDCDSSEAYANHSSSFIGSALQDQASRLGVPVGILSAGMVASS
• Raised in
  Rabbit
• Specificity
  FANCA antibody was raised against the N terminal of FANCA
• Cross Reactivity
  Human
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FANCA antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  FANCA Blocking Peptide, catalog no. 33R-4540, is also available for use as a blocking control in assays to test for specificity of this FANCA antibody
• Additional Information
  This is a rabbit polyclonal antibody against FANCA, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  FANCA  
• Gene symbol
  FANCA
• Short name
  FANCA antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal FANCA antibody raised against the N terminal of FANCA
• Alternative technique
  antibodies
• Alternative to gene target
  Fanconi anemia, complementation group A, FA and FA-H and FA1 and FAA and FACA and FAH and FANCH, FANCA and IDBG-48213 and ENSG00000187741 and 2175, protein binding, nuclei, Fanca and IDBG-198733 and ENSMUSG00000032815 and 14087, FANCA and IDBG-630970 and ENSBTAG00000001906 and

Gene info

• Identity
  HGNC:3582
• Gene
  FANCA
• Long gene name
  FA complementation group A
• Synonyms gene
  • FACA
  • FANCH
• Synonyms gene name
  • Fanconi anemia complementation group A
• Synonyms
  • FAA
  • FA-H
  • FAH
• GenBank acession
  • Z83067
• Locus
  16q24.3
• Discovery year
  1995-12-22
• Entrez gene record
  2175
• Pubmed identfication
  • 7581462
  • 9382107
• Classification
  • FA complementation groups
  • FA core complex
• VEGA ID
  OTTHUMG00000173049
• Locus Specific Databases
  • Fanconi Anaemia Mutation Database
  • Global Variome shared LOVD
  • LRG_495

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products